PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00011449-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 676aa    MW: 75740.3 Da    PI: 5.1376
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00011449-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS332.48.4e-1023606761319
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+ lL++cA+av+ +d++ a+++L+++++las +gd +qRla yf+ +L arl++s+ +l+ +l++  ts    +e l+a++l+  + P+ k+
  PSME_00011449-RA 360 LRALLVHCAQAVAIDDTRGANEILKQIRQLASAYGDGTQRLANYFADGLVARLSGSGGKLFTTLSTGLTS---AAEILKAYQLLLVAHPYRKM 449
                       5789************************************************************999999...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       sh+++ q++l+ +e+++r+Hi+Df+i +G+QWp+L+q La+Rp+gpp+lRiTg++ p++g   +e++eetg+rLa++A+++gvpfe+++ +a+
  PSME_00011449-RA 450 SHFLTYQTVLNVAEKSTRLHIVDFGILYGFQWPSLIQCLANRPGGPPMLRITGIDFPQPGfrAAERIEETGRRLADYAKSFGVPFEYHA-IAT 541
                       ***********************************************************9*9***************************.7** PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e+l++eeL+++++E+l+Vn++++  +llde+v l+s+r+ vL+ ++s++P+v+++   +  + ++ F +rf eal +ysalfd++e+ +pr
  PSME_00011449-RA 542 KWENLDVEELSLRSDEVLVVNCMHRFNNLLDETVVLDSPRNIVLNKIRSMNPRVFIHGVVNGAYKAPFFITRFREALFHYSALFDAMETIVPR 634
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerl 319
                       e  +r  +E+el+grei nvvaceg er+er et+++W+ r+
  PSME_00011449-RA 635 ERPQRLLLEKELFGREILNVVACEGLERVERPETYKQWQVRI 676
                       ***************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.712334676IPR005202Transcription factor GRAS
PfamPF035142.9E-99360676IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MADKKTAIFY SNNMNGGSNN IGFQRPWLQQ ETAMPATQFR GSLSSEKSII TSEGESEDTE  60
VYSDIVLKYI SDMLMDENME DKKCMYQECS ALQATVKPFY DILGENYPPQ GLCNSNIVGE  120
NQNLSLNYYE EDVQNKIEDS SWIGDFFNSQ NPSGFESPLS ANISAGYSSQ YSFGSSGSST  180
VIDGLPDSPI YELSLSELFS EGKEGLGVGQ FEEAVQVAPK RNIGHSMENG WHFQAPKKES  240
DLDLQVGKRE DAIGVAFQSN AAHSDDENGP KRQKDPHRED LDLEDRQSNK LSAVYSDNVI  300
RTESFDKILL CSGNGRVFLD LQLEILQNGV QKSVQSGSVK GLQGSKARER KQGKREVVDL  360
RALLVHCAQA VAIDDTRGAN EILKQIRQLA SAYGDGTQRL ANYFADGLVA RLSGSGGKLF  420
TTLSTGLTSA AEILKAYQLL LVAHPYRKMS HFLTYQTVLN VAEKSTRLHI VDFGILYGFQ  480
WPSLIQCLAN RPGGPPMLRI TGIDFPQPGF RAAERIEETG RRLADYAKSF GVPFEYHAIA  540
TKWENLDVEE LSLRSDEVLV VNCMHRFNNL LDETVVLDSP RNIVLNKIRS MNPRVFIHGV  600
VNGAYKAPFF ITRFREALFH YSALFDAMET IVPRERPQRL LLEKELFGRE ILNVVACEGL  660
ERVERPETYK QWQVRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-473646748316GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262535.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA3E2G20.0A3E2G2_PINRA; SCARECROW-like protein 1
STRINGVIT_08s0007g00510.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-157GRAS family protein